| Desktop | 71/100 | ❗ |
| Mobile | 42/100 | ✘ |
| Field | Data | Result |
|---|---|---|
| Page Size | 59 KB | ✔ |
| Compression | 17 KB (-70.9%) | ✔ |
| Text/Html Ratio | 3545 / 60600 (bytes) = 5.85% | ❗ |
| Load Time | 0.61 second | ✔ |
| Mobile Ready | 0/100 | ✘ |
| In-Page Links | 34 | ✔ |
| Doc Type | HTML 5 | ✔ |
| Encoding | UTF-8 | ✔ |
| Declared Language | NL-NL | ✔ |
| Preferred Domain | Yes | ✔ |
| Robots.txt | Yes | ✔ |
| Url Rewrite | No | ✔ |
| Underscores in url | No | ✔ | Images Without ALT | 1 / 3 | ❗ |
| Embedded Objects (Desktop) | No | ✔ |
| Embedded Objects (Mobile) | Yes | ✘ |
| Iframe | Yes | ✘ |
| Custom 404 page | Yes | ✔ |
| Email Privacy | Yes | ✔ |
| Gsafe browsing | Yes | ✔ |
| Analytics | No | ✘ |
| W3C Validity | No | ✘ |
| Keywords | Freq | Title | Desc | <H> |
|---|---|---|---|---|
| over | 13 | ✘ | ✔ | ✘ |
| cookies | 10 | ✘ | ✘ | ✘ |
| evidensia | 6 | ✘ | ✘ | ✘ |
| naar | 6 | ✘ | ✘ | ✘ |
| website | 5 | ✘ | ✘ | ✘ |
| dierenziekenhuis | 5 | ✘ | ✘ | ✘ |
| meer | 5 | ✘ | ✔ | ✘ |
| informatie | 4 | ✘ | ✘ | ✘ |
| voor | 4 | ✘ | ✔ | ✘ |
| onze | 4 | ✘ | ✔ | ✘ |
| deze | 4 | ✘ | ✘ | ✘ |
| dierenkliniek | 4 | ✔ | ✔ | ✘ |
| stuur | 4 | ✘ | ✘ | ✘ |
| nieuws | 3 | ✘ | ✘ | ✘ |
| lees | 3 | ✘ | ✘ | ✘ |
|
With 0.61 seconds in page load, 59 KB of page size and all other reports below, the dierenkliniekhattemwapenveld.nl has a SEO score of 60 out of 100 |
| Title | Uw dierenarts in Hattem | Dierenkliniek Hattem |
| Description | Wij zijn een toegewijde dierenkliniek dat altijd voor u klaar staat in regio Hattem. Ontdek meer over onze praktijk en mogelijkheden. |
| Keyword |
| Age | 18 Years, 192 Days |
| Created | 3rd-Mar-2005 |
| Updated | 18th-Jan-2023 |
| Expiry | N/a |
| Host | Type | Ttl | Other |
|---|---|---|---|
| dierenkliniekhattemwapenveld.nl | A | 3591 | ip:13.248.160.137 |
| dierenkliniekhattemwapenveld.nl | A | 3591 | ip:76.223.34.124 |
| dierenkliniekhattemwapenveld.nl | NS | 3590 | target:world.excedodns.org |
| dierenkliniekhattemwapenveld.nl | NS | 3590 | target:nordic.excedodns.net |
| dierenkliniekhattemwapenveld.nl | NS | 3590 | target:sto.excedodns.se |
| dierenkliniekhattemwapenveld.nl | NS | 3590 | target:emea.excedodns.eu |
| dierenkliniekhattemwapenveld.nl | NS | 3590 | target:global.excedodns.com |
| dierenkliniekhattemwapenveld.nl | SOA | 86400 | mname:global.excedodns.comrname:hostmaster.excedo.seserial:1685428391refresh:3600retry:900expire:604800minimum-ttl:3600 |
| dierenkliniekhattemwapenveld.nl | MX | 3600 | pri:20target:mx1.groningenserver.nl |
| dierenkliniekhattemwapenveld.nl | MX | 3600 | pri:10target:mx2.groningenserver.nl |
| dierenkliniekhattemwapenveld.nl | TXT | 3600 | txt:spf2.0/pra,mfrom a mx include:spf.mailhoster.nl include:filtermail.eu ~all |
| dierenkliniekhattemwapenveld.nl | TXT | 3600 | txt:v=spf1 a mx include:spf.mailhoster.nl include:filtermail.eu ~all |
|
HTTP/1.1 301 Moved Permanently Date: Mon, 11 Sep 2023 09:19:21 GMT Content-Type: text/html Content-Length: 158 Connection: keep-alive ER-Request-ID: 632ee7ea8508a9aab4c56ffbedee4c35 Pragma: no-cache Cache-Control: no-store, max-age=0 X-Content-Type-Options: nosniff ER-Rule-Id: r-025ae85f-be04-4c7f-99c4-309b3fa05cb6 Location: https://www.dierenkliniekhattem.nl/ Server: EasyRedir HTTP/2 200 cache-control: no-cache, no-store, must-revalidate,no-cache, max-age=604800 pragma: no-cache content-type: text/html; charset=utf-8 expires: -1 server: set-cookie: ai_user=bd4212a2-f7a0-4edf-8bb1-6469de567910|2023-09-11T11:19:21.705Z; expires=Fri, 31-Dec-9999 23:59:59 GMT; path=/; secure; HttpOnly x-frame-options: SAMEORIGIN set-cookie: CMSPreferredCulture=nl-NL; expires=Wed, 11-Sep-2024 09:19:21 GMT; path=/; secure; HttpOnly set-cookie: CMSCsrfCookie=TsDyQg6w1kP89cwR0Ake2MlUZ4eR8y98xwz3FKkO; path=/; secure; HttpOnly set-cookie: ASP.NET_SessionId=qpyqickihw4kp5500c0x5hd1; path=/; secure; HttpOnly; SameSite=Lax x-ua-compatible: IE=Edge request-context: appId=cid-v1:d9d62b47-3f26-459a-aec2-49611e73c714 x-xss-protection: 1; mode=block x-content-type-options: nosniff content-security-policy: frame-ancestors 'self'; form-action 'self'; default-src 'self' 'unsafe-inline' 'unsafe-eval' data: https://WEU-AZ-WEB-NL-CDNEP.azureedge.net/ https://WEU-AZ-WEB-NL-DEV-CDNEP.azureedge.net/ https://WEU-AZ-WEB-NL-UAT-CDNEP.azureedge.net/ https://ivc-dev-ep-01.azureedge.net/ https://fonts.gstatic.com https://fonts.googleapis.com https://az416426.vo.msecnd.net/ https://www.googletagmanager.com/ https://dc.services.visualstudio.com/ https://www.google-analytics.com/ https://static.hotjar.com/ https://stats.g.doubleclick.net/ https://script.hotjar.com/ https://vars.hotjar.com/ https://www.google.com/ https://www.google.nl/ https://in.hotjar.com/ https://vc.hotjar.io/ https://static.elfsight.com/ https://apps.elfsight.com/ https://www.youtube.com/ https://az416426.vo.msecnd.net/ https://service-reviews-ultimate.elfsight.com/ https://js.stripe.com/ https://www.google.com/ https://www.gstatic.com/ https://www.facebook.com/ https://booking.vetstoria.com/ https://www.google.co.uk/ https://ajax.googleapis.com/ https://docs.google.com/ https://cdn-images.mailchimp.com/ https://s3.amazonaws.com/ https://www.klantenvertellen.nl/ https://service2.loyaltyinabox.com https://www.mijnspaar.nl/ https://i.ytimg.com/ https://www.youtube-nocookie.com/ https://86053.outsitetijdelijk.afas.online/ https://region1.analytics.google.com/ https://region1.google-analytics.com/ https://www.googleadservices.com https://www.google.com/ https://googleads.g.doubleclick.net https://www.google.com/ https://adservice.google.com/ https://www.loyaltymanager.nl/ https://cdn.cookielaw.org/ https://geolocation.onetrust.com/cookieconsentpub/v1/geo/location https://widget.trustpilot.com/ https://privacyportal-de.onetrust.com/ https://dash.elfsight.com/ https://core.service.elfsight.com/ x-frame-options: ALLOW strict-transport-security: max-age=31536000; includeSubDomains date: Mon, 11 Sep 2023 09:19:21 GMT set-cookie: visid_incap_2957063=NQrSgGfxTI+b3Ls9akKtxpjb/mQAAAAAQUIPAAAAAAB5cJM2ZlVkv8C8IvD7kNYa; expires=Mon, 09 Sep 2024 09:36:25 GMT; HttpOnly; path=/; Domain=.dierenkliniekhattem.nl set-cookie: incap_ses_1338_2957063=n9rBKl6543NXWRnOyIiREpnb/mQAAAAAjY9OT1K7uFI2QM4QAJqJXQ==; path=/; Domain=.dierenkliniekhattem.nl x-cdn: Imperva x-iinfo: 12-125587567-125587573 NNNN CT(77 77 0) RT(1694423960973 19) q(0 0 2 0) r(3 4) U12 |
| Domain name: dierenkliniekhattemwapenveld.nl Status: active Registrar: AB NameISP Teknikhuset, Radiovägen 2 421 47 Goteborg Sweden Abuse Contact: +46.313011220 abuse@nameisp.com Creation Date: 2005-03-03 Updated Date: 2023-01-18 DNSSEC: no Domain nameservers: emea.excedodns.eu global.excedodns.com nordic.excedodns.net sto.excedodns.se world.excedodns.org Record maintained by: SIDN BV Copyright notice No part of this publication may be reproduced, published, stored in a retrieval system, or transmitted, in any form or by any means, electronic, mechanical, recording, or otherwise, without prior permission of SIDN. These restrictions apply equally to registrars, except in that reproductions and publications are permitted insofar as they are reasonable, necessary and solely in the context of the registration activities referred to in the General Terms and Conditions for .nl Registrars. Any use of this material for advertising, targeting commercial offers or similar activities is explicitly forbidden and liable to result in legal action. Anyone who is aware or suspects that such activities are taking place is asked to inform SIDN. (c) SIDN BV, Dutch Copyright Act, protection of authors' rights (Section 10, subsection 1, clause 1). |
| Server IP | 13.248.160.137 |
| Server Location | United States of America |
| Service Provider | AMAZON-02 |
| Domains (TLD) | Status |
|---|---|
| dierenkliniekhattemwapenveld.com | Available |
| dierenkliniekhattemwapenveld.net | Available |
| dierenkliniekhattemwapenveld.org | Already Registered |
| dierenkliniekhattemwapenveld.biz | Available |
| dierenkliniekhattemwapenveld.io | Already Registered |
| Domains (TLD) | Status |
|---|---|
| dierenkliniekhatemwapenveld.nl | Available |
| xierenkliniekhattemwapenveld.nl | Available |
| sierenkliniekhattemwapenveld.nl | Already Registered |
| wierenkliniekhattemwapenveld.nl | Available |
| eierenkliniekhattemwapenveld.nl | Available |
| Pleasantvieworchardin.com |
| Seresmitologicos.net |
| Mixergrinderguide.in |
| Centerstateceoequity.com |
| Sophisticatedape.com |
| Hopetonbank.com |
| Pirateiro.com |
| Infinitiofmemphis.com |
| Casterhappy.com |
| Tmtrdg.com |